General Information

  • ID:  hor005337
  • Uniprot ID:  P35808
  • Protein name:  Adipokinetic hormone precursor-related peptide beta chain
  • Gene name:  NA
  • Organism:  Schistocerca gregaria (Desert locust) (Gryllus gregarius)
  • Family:  AKH/HRTH/RPCH family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Schistocerca (genus), Cyrtacanthacridinae (subfamily), Acrididae (family), Acridoidea (superfamily), Acridomorpha, Acrididea (infraorder), Caelifera (suborder), Orthoptera (order), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007629 flight behavior
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YADPNADPMAFLTKLIQIEARKLSGCSN
  • Length:  28
  • Propeptide:  QLNFSTGWGRRYADPNADPMAFLTKLIQIEARKLSGCSN
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  This hormone, released from cells in the corpora cardiaca, causes release of diglycerides from the fat body and stimulation of muscles to use these diglycerides as an energy source during energy-demanding processes.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  26-26
  • Structure ID:  AF-P35808-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005337_AF2.pdbhor005337_ESM.pdb

Physical Information

Mass: 354932 Formula: C134H216N36O42S2
Absent amino acids: HVW Common amino acids: A
pI: 6.38 Basic residues: 3
Polar residues: 8 Hydrophobic residues: 10
Hydrophobicity: -20.36 Boman Index: -3921
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 83.93
Instability Index: 2337.86 Extinction Coefficient cystines: 1490
Absorbance 280nm: 55.19

Literature

  • PubMed ID:  NA
  • Title:  NA